
NBP1-70493 CEACAM16 antibody

See related secondary antibodies

Search for all "CEACAM16"

Quick Overview

Rabbit anti Human, Mouse CEACAM16

Product Description for CEACAM16

Rabbit anti Human, Mouse CEACAM16.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CEACAM16

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CEACAM16(carcinoembryonic antigen-related cell adhesion molecule 16) The peptide sequence was selected from the middle region of CEACAM16. Peptide sequence LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLV
Background CEACAM16 belongs to the immunoglobulin superfamily, CEA family.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 3885510

Accessory Products

  • LinkedIn