TA338984 CENP-A antibody

Rabbit Polyclonal Anti-CENPA Antibody

See related secondary antibodies

Search for all "CENP-A"

50 µg / €391.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Zebrafish CENP-A

TA338984

More Views

  • TA338984

Product Description for CENP-A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Zebrafish CENP-A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CENP-A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CENPA, Centromere autoantigen A, Centromere protein A, Histone H3-like centromeric protein A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49450
Immunogen:
The immunogen for anti-CENPA antibody: synthetic peptide directed towards the middle region of human CENPA. Synthetic peptide located within the following region: ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG.
GeneID:
1058
Application WB
Background Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventiol histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. Altertive splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CENP-A (7 products)

Catalog No. Species Pres. Purity   Source  

CENP-A (transcript variant 2)

CENP-A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

CENP-A (transcript variant 1)

CENP-A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

CENP-A

CENP-A Human Purified > 90.0% as determined by SDS-PAGE. 
Purification Method: Proprietary chromatographic techniques.
Insect cells
  OriGene Technologies GmbH

CENP-A

CENP-A Human Purified > 90.0% as determined by SDS-PAGE. 
Purification Method: Proprietary chromatographic techniques.
Insect cells
  OriGene Technologies GmbH

CENP-A

CENP-A Human Purified > 90.0% as determined by SDS-PAGE. 
Purification Method: Proprietary chromatographic techniques.
Insect cells
  OriGene Technologies GmbH

CENP-A

CENP-A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CENP-A

CENP-A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CENP-A (3 products)

Catalog No. Species Pres. Purity   Source  

CENPA Lysate

Western Blot: CENPA Lysate [NBL1-09081] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CENPA
  Novus Biologicals Inc.

CENPA Lysate

Western Blot: CENPA Lysate [NBL1-09082] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CENPA
  Novus Biologicals Inc.

CENPA overexpression lysate

CENPA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn