NBP1-74084 CGI-16 antibody

See related secondary antibodies

Search for all "CGI-16"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CGI-16


Product Description for CGI-16

Rabbit anti Human CGI-16.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CGI-16

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to the C terminal of ACOT9. Immunizing peptide sequence FLSSQVCFTQNNYIQVRVHSEVASLQEKQHTTTNVFHFTFMSEKEVPLVF.
Background The protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose.
Aff - Purified

Accessory Products

  • LinkedIn