discontinued

AP42064PU-N CHAMP1 / ZNF828 antibody

See related secondary antibodies

Search for all "CHAMP1 / ZNF828"

Quick Overview

Rabbit anti Human, Mouse, Rat CHAMP1 / ZNF828

AP42064PU-N

More Views

  • AP42064PU-N

Product Description for CHAMP1 / ZNF828

Rabbit anti Human, Mouse, Rat CHAMP1 / ZNF828.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CHAMP1 / ZNF828

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms C13orf8, CAMP, Chromosome alignment-maintaining phosphoprotein 1, KIAA1802
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JM3
Immunogen:
The immunogen for anti-CHAMP1 antibody: synthetic peptide directed towards the middle region of human CHAMP1.
AA Sequence:
PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG
GeneID:
283489
Application Western blotting (0.5 - 2 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background CHAMP1 is required for proper alignment of chromosomes at metaphase and their accurate segregation during mitosis. Involved in the maintenance of spindle microtubules attachment to the kinetochore during sister chromatid biorientation. It may recruit CENPE and CENPF to the kinetochore. CHAMP1 is phosphorylated by CDK1. Mitotic phosphorylation is required for the attachment of spindle microtubules to the kinetochore.
General Readings Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Storage Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format
Purification:
Purified on Protein A affinity column
State:
Lyophilised from PBS
Aff - Purified
Reconstitution:
Add 100 μl of distilled water
Species Reactivity
Species reactivity (expected):
Mouse, Rat
Species reactivity (tested):
Human
Gene ID 283489

Accessory Products

Proteins and/or Positive Controls

Proteins for CHAMP1 / ZNF828 (2 products)

Catalog No. Species Pres. Purity   Source  

CHAMP1 / ZNF828

CHAMP1 / ZNF828 Human Purified
  Abnova Taiwan Corp.

CHAMP1 / ZNF828

CHAMP1 / ZNF828 Human Purified
  Abnova Taiwan Corp.

Positive controls for CHAMP1 / ZNF828 (5 products)

Catalog No. Species Pres. Purity   Source  

C13orf8 293T Cell Transient Overexpression Lysate(Denatured)

C13orf8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

C13orf8 Lysate

Western Blot: C13orf8 Lysate [NBL1-18255] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF828
  Novus Biologicals Inc.

CHAMP1 overexpression lysate

CHAMP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CHAMP1 overexpression lysate

CHAMP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CHAMP1 overexpression lysate

CHAMP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn