discontinued

H00283489-B01P CHAMP1 / ZNF828 antibody

See related secondary antibodies

Search for all "CHAMP1 / ZNF828"

Quick Overview

Mouse anti Human CHAMP1 / ZNF828

H00283489-B01P

More Views

  • H00283489-B01P

Product Description for CHAMP1 / ZNF828

Mouse anti Human CHAMP1 / ZNF828.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for CHAMP1 / ZNF828

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms C13orf8, CAMP, Chromosome alignment-maintaining phosphoprotein 1, KIAA1802
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JM3
Immunogen:
C13orf8 (NP_115812.1, 1 a.a. ~ 812 a.a) full-length human protein.
AA Sequence:
MEAFQELRKPSARLECDHCSFRGTDYENVQIHMGTIHPEFCDEMDAGGLGKMIFYQKSAKLFHCHKCFFTSKMYSN VYYHITSKHASPDKWNDKPKNQLNKETDPVKSPPLPEHQKIPCNSAEPKSIPALSMETQKLGSVLSPESPKPTPLT PLEPQKPGSVVSPELQTPLPSPEPSKPASVSSPEPPKSVPVCESQKLAPVPSPEPQKPAPVSPESVKATLSNPKPQ KQSHFPETLGPPSASSPESPVLAASPEPWGPSPAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPA PAVSPGSWKPGPPGSPRPWKSNPSASSGPWKPAKPAPSVSPGPWKPIPSVSPGPWKPTPSVSSASWKSSSVSPSSW KSPPASPESWKSGPPELRKTAPTLSPEHWKAVPPVSPELRKPGPPLSPEIRSPAGSPELRKPSGSPDLWKLSPDQR KTSPASLDFPESQKSSRGGSPDLWKSSFFIEPQKPVFPETRKPGPSGPSESPKAASDIWKPVLSIDTEPRKPALFP EPAKTAPPASPEARKRALFPEPRKHALFPELPKSALFSESQKAVELGDELQIDAIDDQKCDILVQEELLASPKKLL EDTLFPSSKKLKKDNQESSDAELSSSEYIKTDLDAMDIKGQESSSDQEQVDVESIDFSKENKMDMTSPEQSRNVLQ FTEEKEAFISEEEIAKYMKRGKGKYYCKICCCRAMKKGAVLHHLVNKHNVHSPYKCTICGKAFLLESLLKNHVAAH GQSLLKCPRCNFESNFPRGFKKHLTHCQSRHNEEANKKLMEALEPPLEEQQI
GeneID:
283489
Remarks:
Gene Accession: NM_032436
Add. information Mouse polyclonal antibody raised against a full-length human C13orf8 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 283489

Accessory Products

Proteins and/or Positive Controls

Proteins for CHAMP1 / ZNF828 (2 products)

Catalog No. Species Pres. Purity   Source  

CHAMP1 / ZNF828

CHAMP1 / ZNF828 Human Purified
  Abnova Taiwan Corp.

CHAMP1 / ZNF828

CHAMP1 / ZNF828 Human Purified
  Abnova Taiwan Corp.

Positive controls for CHAMP1 / ZNF828 (5 products)

Catalog No. Species Pres. Purity   Source  

C13orf8 293T Cell Transient Overexpression Lysate(Denatured)

C13orf8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

C13orf8 Lysate

Western Blot: C13orf8 Lysate [NBL1-18255] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF828
  Novus Biologicals Inc.

CHAMP1 overexpression lysate

CHAMP1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CHAMP1 overexpression lysate

CHAMP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CHAMP1 overexpression lysate

CHAMP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn