NBP1-57105 CHD1L antibody

See related secondary antibodies

Search for all "CHD1L"

0.1 mg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat CHD1L


Product Description for CHD1L

Rabbit anti Human, Mouse, Rat CHD1L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CHD1L

Product Category Primary Antibodies
Quantity 0.1 mg
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CHD1L (chromodomain helicase DNA binding protein 1-like) The peptide sequence was selected from the middle region of CHD1L . Peptide sequence DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL.
Background CHD1L encodes a protein that interacts with ADP-ribose. ADP-ribosylation of proteins is an important post-translational modification that occurs in a variety of biological processes, including DNA repair, transcription, chromatin biology and long-term memory formation.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.

Accessory Products

  • LinkedIn