discontinued

H00001107-M01 CHD3 antibody

See related secondary antibodies

Search for all "CHD3"

Quick Overview

Mouse anti Human CHD3 5E12

Product Description for CHD3

Mouse anti Human CHD3 5E12.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for CHD3

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms ATP-dependent helicase CHD3, CHD-3, Chromodomain-helicase-DNA-binding protein 3, Mi-2 autoantigen 240 kDa protein, Mi2-alpha, Zinc finger helicase, hZFH
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 5E12
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q12873
Immunogen:
CHD3 (NP_001005273, 1654 a.a. ~ 1742 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERA AISSGKLNEIWH*
GeneID:
1107
Remarks:
Gene Accession: NM_001005273
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant CHD3.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 1107

Accessory Products

Proteins and/or Positive Controls

Proteins for CHD3 (2 products)

Catalog No. Species Pres. Purity   Source  

CHD3

CHD3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CHD3

CHD3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn