discontinued

H00011200-B01P CHK2 antibody

See related secondary antibodies

Search for all "CHK2"

Quick Overview

Mouse anti Human CHK2

H00011200-B01P

More Views

  • H00011200-B01P
  • H00011200-B01P

Product Description for CHK2

Mouse anti Human CHK2.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for CHK2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CHEK-2, CHEK2, CHK-2, CHK2 checkpoint homolog, Cds1, RAD53, Serine/threonine-protein kinase Chk2
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O96017
Immunogen:
CHEK2 (NP_009125.1, 1 a.a. ~ 543 a.a) full-length human protein.
AA Sequence:
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTLSSLETVSTQELYSIPE DQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREVGP KNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGS GACGEVKLAFERKTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELM EGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSL MRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVS EKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAET TKRPAVCAAVL
GeneID:
11200
Remarks:
Gene Accession: NM_007194.3
Add. information Mouse polyclonal antibody raised against a full-length human CHEK2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 11200

Accessory Products

Proteins and/or Positive Controls

Proteins for CHK2 (6 products)

Catalog No. Species Pres. Purity   Source  

CHK2 (transcript variant 1)

CHK2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

CHK2

CHK2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CHK2

CHK2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CHK2

CHK2 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

CHK2

CHK2 Human 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

CHK2

CHK2 Human
  Abnova Taiwan Corp.

Positive controls for CHK2 (4 products)

Catalog No. Species Pres. Purity   Source  

CHEK2 293T Cell Transient Overexpression Lysate(Denatured)

CHEK2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CHEK2 overexpression lysate

CHEK2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CHEK2 overexpression lysate

CHEK2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

Chk2 Lysate

Western Blot: Chk2 Lysate [NBL1-09147] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CHEK2.
  Novus Biologicals Inc.
  • LinkedIn