TA336149 CISD2 antibody

Rabbit Polyclonal Anti-CISD2 Antibody

See related secondary antibodies

Search for all "CISD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CISD2

Product Description for CISD2

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CISD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CISD2

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms CDGSH iron sulfur domain-containing protein 2, CDGSH2, ERIS, Endoplasmic reticulum intermembrane small protein, Miner1, MitoNEET-related 1 protein, NAF1, Nutrient-deprivation autophagy factor-1, ZCD2
Presentation Purified
Reactivity Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-CISD2 Antibody: synthetic peptide directed towards the N terminal of human CISD2. Synthetic peptide located within the following region: VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL.
Application WB
Background CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for CISD2 (5 products)

Catalog No. Species Pres. Purity   Source  

CISD2 (full length, N-term HIS tag)

CISD2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.


CISD2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


CISD2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


CISD2 Human Purified
  Novus Biologicals Inc.


CISD2 Human Purified
  Novus Biologicals Inc.

Positive controls for CISD2 (2 products)

Catalog No. Species Pres. Purity   Source  

CISD2 Lysate

Western Blot: CISD2 Lysate [NBL1-09215] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CISD2
  Novus Biologicals Inc.

CISD2 overexpression lysate

CISD2 overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn