H00023122-M01 CLASP2 antibody

See related secondary antibodies

Search for all "CLASP2"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CLASP2 3E9

H00023122-M01

Product Description for CLASP2

Mouse anti Human CLASP2 3E9.
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for CLASP2

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms -
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3E9
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NB74
Immunogen:
CLASP2 (AAH29035.1, 1 a.a. ~ 431 a.a) full-length recombinant protein with GST tag.
AA Sequence:
MRRLICKRICDYKSFDDEESVDGNRPSSAASAFKVPAPKTSGNPANSARKPGSAGGPKVGGASKEGGAGAVDEDDF IKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAK DLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIPLITSNCT SKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEP SYQKSLQTYLKSSGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSAGSSKASSLPGSLQRSRSDIDV NAAAGAKAHHAAGQSVRSGRLGAGALNAGSYASLECEAFWRSGRTAKLYSV
GeneID:
23122
Add. information Mouse monoclonal antibody raised against a full-length recombinant CLASP2.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.4.
Specificity
Specificity:
Antibody Reactive Against Recombinant Protein.

Accessory Products

  • LinkedIn