discontinued

H00009076-B01P Claudin-1 / CLDN1 antibody

See related secondary antibodies

Search for all "Claudin-1 / CLDN1"

Quick Overview

Mouse anti Human Claudin-1 / CLDN1

Product Description for Claudin-1 / CLDN1

Mouse anti Human Claudin-1 / CLDN1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Claudin-1 / CLDN1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CLD1, PRO944, SEMP1, Senescence-associated epithelial membrane protein, UNQ481
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O95832
Immunogen:
CLDN1 (NP_066924.1, 1 a.a. ~ 211 a.a) full-length human protein.
AA Sequence:
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSLLNLSST LQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPM TPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV
GeneID:
9076
Remarks:
Gene Accession: NM_021101.3
Add. information Mouse polyclonal antibody raised against a full-length human CLDN1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9076

Accessory Products

Proteins and/or Positive Controls

Proteins for Claudin-1 / CLDN1 (3 products)

Catalog No. Species Pres. Purity   Source  

Claudin-1 / CLDN1

Claudin-1 / CLDN1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Claudin-1 / CLDN1

Claudin-1 / CLDN1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Claudin-1 / CLDN1

Claudin-1 / CLDN1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Claudin-1 / CLDN1 (3 products)

Catalog No. Species Pres. Purity   Source  

Claudin 1 Lysate

Western Blot: Claudin 1 Lysate [NBL1-09235] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CLDN1
  Novus Biologicals Inc.

CLDN1 293T Cell Transient Overexpression Lysate(Denatured)

CLDN1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CLDN1 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

CLDN1 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-CLDN1 antibody (H00009076-M01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn