discontinued

H00009076-M01 Claudin-1 / CLDN1 antibody

See related secondary antibodies

Search for all "Claudin-1 / CLDN1"

Quick Overview

Mouse anti Human Claudin-1 / CLDN1 1C5-D9

H00009076-M01

More Views

  • H00009076-M01
  • H00009076-M01
  • H00009076-M01
  • H00009076-M01
  • H00009076-M01

Product Description for Claudin-1 / CLDN1

Mouse anti Human Claudin-1 / CLDN1 1C5-D9.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for Claudin-1 / CLDN1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CLD1, PRO944, SEMP1, Senescence-associated epithelial membrane protein, UNQ481
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 1C5-D9
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O95832
Immunogen:
CLDN1 (AAH12471, 1 a.a. ~ 212 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSLLNLSST LQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPM TPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV*
GeneID:
9076
Remarks:
Gene Accession: BC012471
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a full length recombinant CLDN1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,S-ELISA,WB-Ce,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9076

Accessory Products

Proteins and/or Positive Controls

Proteins for Claudin-1 / CLDN1 (3 products)

Catalog No. Species Pres. Purity   Source  

Claudin-1 / CLDN1

Claudin-1 / CLDN1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Claudin-1 / CLDN1

Claudin-1 / CLDN1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Claudin-1 / CLDN1

Claudin-1 / CLDN1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Claudin-1 / CLDN1 (3 products)

Catalog No. Species Pres. Purity   Source  

Claudin 1 Lysate

Western Blot: Claudin 1 Lysate [NBL1-09235] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CLDN1
  Novus Biologicals Inc.

CLDN1 293T Cell Transient Overexpression Lysate(Denatured)

CLDN1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CLDN1 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

CLDN1 HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-CLDN1 antibody (H00009076-M01) by Western Blots.
  Abnova Taiwan Corp.
  • LinkedIn