NBP1-91046 CLEC12B antibody

See related secondary antibodies

Search for all "CLEC12B"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CLEC12B

Product Description for CLEC12B

Rabbit anti Human CLEC12B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for CLEC12B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSP
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 387837

Accessory Products

Proteins and/or Positive Controls

Proteins for CLEC12B (1 products)

Catalog No. Species Pres. Purity   Source  

C-type lectin domain family 12, member B (CLEC12B), transcript variant 1 (transcript variant 1)

C-type lectin domain family 12, member B (CLEC12B), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for CLEC12B (2 products)

Catalog No. Species Pres. Purity   Source  

CLEC12B overexpression lysate

CLEC12B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

CLEC12B overexpression lysate

CLEC12B overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn