
NBP1-91046 CLEC12B antibody

See related secondary antibodies

Search for all "CLEC12B"

Quick Overview

Rabbit anti Human CLEC12B

Product Description for CLEC12B

Rabbit anti Human CLEC12B.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for CLEC12B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSP
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
Aff - Purified
Gene ID 387837

Accessory Products

Proteins and/or Positive Controls

Proteins for CLEC12B (1 products)

Catalog No. Species Pres. Purity   Source  

C-type lectin domain family 12, member B (CLEC12B), transcript variant 1 (transcript variant 1)

C-type lectin domain family 12, member B (CLEC12B), transcript variant 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for CLEC12B (2 products)

Catalog No. Species Pres. Purity   Source  

CLEC12B overexpression lysate

CLEC12B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CLEC12B overexpression lysate

CLEC12B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn