discontinued

H00009976-B02 CLEC2B antibody

See related secondary antibodies

Search for all "CLEC2B"

Quick Overview

Mouse anti Human CLEC2B

Product Description for CLEC2B

Mouse anti Human CLEC2B.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CLEC2B

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms AICL, Activation-induced C-type lectin, C-type lectin domain family 2 member B, C-type lectin superfamily member 2, CLECSF2, IFN-alpha2b-inducing-related protein 1, IFNRG1
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q92478
Immunogen:
CLEC2B (NP_005118.2, 1 a.a. ~ 149 a.a) full-length human protein.
AA Sequence:
MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNI EEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH
GeneID:
9976
Remarks:
Gene Accession: NM_005127.2
Add. information Mouse polyclonal antibody raised against a full-length human CLEC2B protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 9976

Accessory Products

Proteins and/or Positive Controls

Proteins for CLEC2B (4 products)

Catalog No. Species Pres. Purity   Source  

CLEC2B (26-149, His-tag)

CLEC2B Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €730.00
  Acris Antibodies GmbH

CLEC2B (26-149, His-tag)

CLEC2B Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €300.00
  Acris Antibodies GmbH

CLEC2B

CLEC2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CLEC2B

CLEC2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CLEC2B (4 products)

Catalog No. Species Pres. Purity   Source  

CLEC2B 293T Cell Transient Overexpression Lysate(Denatured)

CLEC2B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CLEC2B 293T Cell Transient Overexpression Lysate(Denatured)

CLEC2B 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CLEC2B Lysate

Western Blot: AICL Lysate [NBL1-09257] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CLEC2B
  Novus Biologicals Inc.

CLEC2B overexpression lysate

CLEC2B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn