NBP1-93861 CLEC2L antibody

See related secondary antibodies

Search for all "CLEC2L"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CLEC2L

Product Description for CLEC2L

Rabbit anti Human CLEC2L.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for CLEC2L

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P0C7M8
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PEDWLLYGRKCYFFSEEPRDWNTGRQYCHTHEAVLAVIQSQKELEFMFKFTRREPWIGLRRVGDEFHWVNGDPFDPDTFTIAGPGECVFVEP
GeneID:
154790
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 154790

Accessory Products

Proteins and/or Positive Controls

Positive controls for CLEC2L (1 products)

Catalog No. Species Pres. Purity   Source  

CLEC2L overexpression lysate

CLEC2L overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn