discontinued

H00057213-B01 CLLD6 antibody

See related secondary antibodies

Search for all "CLLD6"

Quick Overview

Mouse anti Human CLLD6

Product Description for CLLD6

Mouse anti Human CLLD6.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CLLD6

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms C13orf1, CLL deletion region gene 6 protein, Chronic lymphocytic leukemia deletion region gene 6 protein
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5W111
Immunogen:
C13orf1 (NP_065189.1, 1 a.a. ~ 196 a.a) full-length human protein.
AA Sequence:
MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGI WGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPA SGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF
GeneID:
57213
Remarks:
Gene Accession: NM_020456.1
Add. information Mouse polyclonal antibody raised against a full-length human C13orf1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 57213

Accessory Products

Proteins and/or Positive Controls

Proteins for CLLD6 (4 products)

Catalog No. Species Pres. Purity   Source  

CLLD6 (transcript variant 1)

CLLD6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

CLLD6

CLLD6 Human in vitro transl.
  Abnova Taiwan Corp.

CLLD6

CLLD6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CLLD6

CLLD6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CLLD6 (2 products)

Catalog No. Species Pres. Purity   Source  

C13orf1 293T Cell Transient Overexpression Lysate(Denatured)

C13orf1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SPRYD7 overexpression lysate

SPRYD7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn