discontinued

H00057213-M01 CLLD6 antibody

See related secondary antibodies

Search for all "CLLD6"

Quick Overview

Mouse anti Human, Rat CLLD6 2G4

Product Description for CLLD6

Mouse anti Human, Rat CLLD6 2G4.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for CLLD6

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms C13orf1, CLL deletion region gene 6 protein, Chronic lymphocytic leukemia deletion region gene 6 protein
Presentation Purified
Reactivity Hu, Rt
Applications E, WB
Clonality Monoclonal
Clone 2G4
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5W111
Immunogen:
C13orf1 (NP_065189, 97 a.a. ~ 197 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILD CQFSEFYHTPPPGFEKILFEQQIF*
GeneID:
57213
Remarks:
Gene Accession: NM_020456
Isotype control AM03095PU-N, SM10P (for use in human samples), SM20P (for use in rat samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant C13orf1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Rat
Gene ID 57213

Accessory Products

Proteins and/or Positive Controls

Proteins for CLLD6 (4 products)

Catalog No. Species Pres. Purity   Source  

CLLD6 (transcript variant 1)

CLLD6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

CLLD6

CLLD6 Human in vitro transl.
  Abnova Taiwan Corp.

CLLD6

CLLD6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CLLD6

CLLD6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CLLD6 (2 products)

Catalog No. Species Pres. Purity   Source  

C13orf1 293T Cell Transient Overexpression Lysate(Denatured)

C13orf1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SPRYD7 overexpression lysate

SPRYD7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn