
NBP1-69004 CLNS1A antibody

See related secondary antibodies

Search for all "CLNS1A"

50 µg / €440.00

Quick Overview

Rabbit anti Mouse CLNS1A


Product Description for CLNS1A

Rabbit anti Mouse CLNS1A.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CLNS1A

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to Clns1a (chloride channel, nucleotide-sensitive, 1A) The peptide sequence was selected from the C terminal of Clns1a. Peptide sequence ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA.
Background The function of Clns1a remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 12729

Accessory Products

  • LinkedIn