discontinued

NBP1-70501 CLRN1 antibody

See related secondary antibodies

Search for all "CLRN1"

Quick Overview

Rabbit anti Human CLRN1

Product Description for CLRN1

Rabbit anti Human CLRN1.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CLRN1

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MYZ0
Immunogen:
Synthetic peptides corresponding to LOC646951(similar to hCG1786685) The peptide sequence was selected from the middle region of LOC646951. Peptide sequence SQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNING.
GeneID:
646951
Background The function of this protein remains unknown.
Concentration Lyoph mg/ml
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 646951

Accessory Products

  • LinkedIn