discontinued

H00154043-B01P CNKSR3 antibody

See related secondary antibodies

Search for all "CNKSR3"

Quick Overview

Mouse anti Human CNKSR3

H00154043-B01P

More Views

  • H00154043-B01P

Product Description for CNKSR3

Mouse anti Human CNKSR3.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for CNKSR3

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CNK homolog protein 3, CNK3, CNKSR family member 3, Connector enhancer of KSR3, Connector enhancer of kinase suppressor of ras 3, MAGI1, Maguin-like protein, Membrane-associated guanylate kinase-interacting protein-like 1
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P9H4
Immunogen:
CNKSR3 (NP_775786, 1 a.a. ~ 555 a.a) full-length human protein.
AA Sequence:
MEPVTKWSPKQVVDWTRGLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQELVLEAVDLLCALNYGL ETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKAPNEFLTSVVELIGAAKALLAWLDRAPFTGITDFSVT KNKIIQLCLDLTTTVQKDCFVAEMEDKVLTVVKVLNGICDKTIRSTTDPVMSQCACLEEVHLPNIKPGEGLGMYIK STYDGLHVITGTTENSPADRSQKIHAGDEVIQVNQQTVVGWQLKNLVKKLRENPTGVVLLLKKRPTGSFNFTPAPL KNLRWKPPLVQTSPPPATTQSPESTMDTSLKKEKSAILDLYIPPPPAVPYSPRDENGSFVYGGSSKCKQPLPGPKG SESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRK GEDALCRYFSNERIPPIIEESSSPPYRFSRPTTERHLVRGADYIRGSRCYINSDLHSSATIPFQEEGTKKKSGSSA TKSSSTEPSLLVSWFTRLKLLTH
GeneID:
154043
Remarks:
Gene Accession: NM_173515
Add. information Mouse polyclonal antibody raised against a full-length human CNKSR3 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 154043

Accessory Products

Proteins and/or Positive Controls

Proteins for CNKSR3 (4 products)

Catalog No. Species Pres. Purity   Source  

CNKSR3

CNKSR3 Human Purified
  Abnova Taiwan Corp.

CNKSR3

CNKSR3 Human Purified
  Abnova Taiwan Corp.

CNKSR3

CNKSR3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CNKSR3

CNKSR3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CNKSR3 (2 products)

Catalog No. Species Pres. Purity   Source  

CNKSR3 Lysate

Western Blot: CNKSR3 Lysate [NBL1-09313] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CNKSR3
  Novus Biologicals Inc.

CNKSR3 overexpression lysate

CNKSR3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn