discontinued

NBP1-94188 CNPY1 antibody

See related secondary antibodies

Search for all "CNPY1"

Quick Overview

Rabbit anti Human CNPY1

Product Description for CNPY1

Rabbit anti Human CNPY1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for CNPY1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3B7I2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANH
GeneID:
285888
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 285888

Accessory Products

Proteins and/or Positive Controls

Proteins for CNPY1 (2 products)

Catalog No. Species Pres. Purity   Source  

CNPY1 (1-92, His-tag)

CNPY1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

CNPY1 (1-92, His-tag)

CNPY1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH
  • LinkedIn