NBP1-94188 CNPY1 antibody

See related secondary antibodies

Search for all "CNPY1"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CNPY1

Product Description for CNPY1

Rabbit anti Human CNPY1.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for CNPY1

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3B7I2
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANH
GeneID:
285888
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Phospate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 285888

Accessory Products

Proteins and/or Positive Controls

Proteins for CNPY1 (2 products)

Catalog No. Species Pres. Purity   Source  

CNPY1 (1-92, His-tag)

CNPY1 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €940.00
  Acris Antibodies GmbH

CNPY1 (1-92, His-tag)

CNPY1 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €370.00
  Acris Antibodies GmbH
  • LinkedIn