discontinued

H00001690-B01P Cochlin antibody

See related secondary antibodies

Search for all "Cochlin"

Quick Overview

Mouse anti Human Cochlin

H00001690-B01P

More Views

  • H00001690-B01P

Product Description for Cochlin

Mouse anti Human Cochlin.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Cochlin

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms COCH, COCH-5B2, COCH5B2
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O43405
Immunogen:
COCH (AAH07230.1, 1 a.a. ~ 494 a.a) full-length human protein.
AA Sequence:
MSAAWIPALGLGVCLLLLPGPAGSEGAAPIAITCFTRGLDIRKEKADVLCPGGCPLEEFSVYGNIVYASVSSICGA AVHRGVISNSGGPVRVYSLPGRENYSSVDANGIQSQMLSRWSASFTVTKGKSSTQEATGQAVSTAHPPTGKRLKKT PEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLKNFTSAKDV LFAIKEVGFRGGNSNTGKALKHTAQKFFTVDAGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFIVSVAKP IPEELGMVQDVTFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMCSKTCYNSVNIAFLIDGSSSVGD SNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRTEFSFTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRN VFGPIRESPNKNFLVIVTDGQSYDDVQGPAAAAHDAAK
GeneID:
1690
Remarks:
Gene Accession: BC007230
Add. information Mouse polyclonal antibody raised against a full-length human COCH protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 1690

Accessory Products

Proteins and/or Positive Controls

Proteins for Cochlin (3 products)

Catalog No. Species Pres. Purity   Source  

Cochlin

Cochlin Human
  Abnova Taiwan Corp.

Cochlin

Cochlin Human Purified
  Abnova Taiwan Corp.

Cochlin

Cochlin Human Purified
  Abnova Taiwan Corp.

Positive controls for Cochlin (1 products)

Catalog No. Species Pres. Purity   Source  

COCH 293T Cell Transient Overexpression Lysate(Denatured)

COCH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn