TA342662 Cochlin antibody

Rabbit Polyclonal Anti-COCH Antibody

See related secondary antibodies

Search for all "Cochlin"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Cochlin

TA342662

Product Description for Cochlin

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Cochlin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cochlin

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms COCH, COCH-5B2, COCH5B2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43405
Immunogen:
The immunogen for anti-COCH antibody: synthetic peptide directed towards the N terminal of human COCH. Synthetic peptide located within the following region: AHPPTGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRRFNLQKNFVGK.
GeneID:
1690
Application WB
Background The protein encoded by this gene is highly conserved in human, mouse, and chicken, showing 94% and 79% amino acid identity of human to mouse and chicken sequences, respectively. Hybridization to this gene was detected in spindle-shaped cells located along nerve fibers between the auditory ganglion and sensory epithelium. These cells accompany neurites at the habenula perforata, the opening through which neurites extend to innervate hair cells. This and the pattern of expression of this gene in chicken inner ear paralleled the histologic findings of acidophilic deposits, consistent with mucopolysaccharide ground substance, in temporal bones from DF9 (autosomal domint nonsyndromic sensorineural deafness 9) patients. Mutations that cause DF9 have been reported in this gene. Altertive splicing results in multiple transcript variants encoding the same protein. Additiol splice variants encoding distinct isoforms have been described but their biological validities have not been demonstrated.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 419% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cochlin (3 products)

Catalog No. Species Pres. Purity   Source  

Cochlin

Cochlin Human
  Abnova Taiwan Corp.

Cochlin

Cochlin Human Purified
  Abnova Taiwan Corp.

Cochlin

Cochlin Human Purified
  Abnova Taiwan Corp.

Positive controls for Cochlin (1 products)

Catalog No. Species Pres. Purity   Source  

COCH 293T Cell Transient Overexpression Lysate(Denatured)

COCH 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn