TA335757 COPS2 / TRIP15 antibody

Rabbit Polyclonal Anti-COPS2 Antibody

See related secondary antibodies

Search for all "COPS2 / TRIP15"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Zebrafish COPS2 / TRIP15

Product Description for COPS2 / TRIP15

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rabbit, Zebrafish COPS2 / TRIP15.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for COPS2 / TRIP15

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Alien homolog, COP9 signalosome complex subunit 2, CSN2, JAB1-containing signalosome subunit 2, SGN2, TRIP-15, Thyroid receptor-interacting protein 15
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-COPS2 Antibody: synthetic peptide directed towards the N terminal of human COPS2. Synthetic peptide located within the following region: SDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAAL.
Application WB
Background COPS2 is an essential component of the COP9 siglosome complex (CSN). The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kises. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. COPS2 is involved in early stage of neurol differentiation via its interaction with NIF3L1.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for COPS2 / TRIP15 (7 products)

Catalog No. Species Pres. Purity   Source  

COPS2 / TRIP15 (transcript variant 1)

COPS2 / TRIP15 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.


COPS2 / TRIP15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


COPS2 / TRIP15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


COPS2 / TRIP15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


COPS2 / TRIP15 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


COPS2 / TRIP15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


COPS2 / TRIP15 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for COPS2 / TRIP15 (1 products)

Catalog No. Species Pres. Purity   Source  

COP9 signalosome complex subunit 2 Lysate

Western Blot: COP9 signalosome complex subunit 2 Lysate [NBL1-09380] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for COPS2
  Novus Biologicals Inc.
  • LinkedIn