TA335668 Coronin-1A antibody

Rabbit Polyclonal Anti-CORO1A Antibody

See related secondary antibodies

Search for all "Coronin-1A"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit Coronin-1A

Product Description for Coronin-1A

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit Coronin-1A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Coronin-1A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CORO1, CORO1A, Clipin-A, Coronin-like protein, Coronin-like protein p57, TACO, Tryptophan aspartate-containing coat protein
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-CORO1A Antibody: synthetic peptide directed towards the middle region of human CORO1A. Synthetic peptide located within the following region: SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVS.
Application WB
Background CORO1A forms homodimers. It plays a role in the cross-linking of F-actin in the cell.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Coronin-1A (3 products)

Catalog No. Species Pres. Purity   Source  


Coronin-1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


Coronin-1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


Coronin-1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Coronin-1A (1 products)

Catalog No. Species Pres. Purity   Source  

Coronin-1a Lysate

Western Blot: Coronin-1a Lysate [NBL1-09395] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CORO1A
  Novus Biologicals Inc.
  • LinkedIn