TA343656 Coronin-1A antibody

Rabbit Polyclonal Anti-CORO1A Antibody

See related secondary antibodies

Search for all "Coronin-1A"

0.1 mg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Coronin-1A

Product Description for Coronin-1A

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Coronin-1A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Coronin-1A

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CORO1, CORO1A, Clipin-A, Coronin-like protein, Coronin-like protein p57, TACO, Tryptophan aspartate-containing coat protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P31146
Immunogen:
The immunogen for anti-CORO1A antibody: synthetic peptide directed towards the C terminal of human CORO1A. Synthetic peptide located within the following region: ELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLD.
GeneID:
11151
Application WB
Background CORO1A is a novel actin-binding protein with a WD repeat and a leucine zipper motif. CORO1A forms homodimers, that the association is mediated by the leucine zipper structure in the C-termil region, and that it plays a role in the cross-linking of F-actin in the cell. The leukocyte plasma membrane associates with the actin cytoskeleton through CORO1A.Downregulation of CORO1A gene transcription restricts entry/survival of mycobacteria within macrophages
Format
Purification:
Protein A purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Coronin-1A (3 products)

Catalog No. Species Pres. Purity   Source  

Coronin-1A

Coronin-1A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Coronin-1A

Coronin-1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Coronin-1A

Coronin-1A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Coronin-1A (1 products)

Catalog No. Species Pres. Purity   Source  

Coronin-1a Lysate

Western Blot: Coronin-1a Lysate [NBL1-09395] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CORO1A
  Novus Biologicals Inc.
  • LinkedIn