
NBP1-55017 Cortactin antibody

See related secondary antibodies

Search for all "Cortactin"

50 µg / €390.00

Quick Overview

Rabbit anti Human, Mouse, Rat Cortactin

Product Description for Cortactin

Rabbit anti Human, Mouse, Rat Cortactin.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Cortactin

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CTTN(cortactin) The peptide sequence was selected from the N terminal of CTTN. Peptide sequence KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG.
Background CTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, CTTN is degraded in a caspase-dependent manner. The aberrant regulation of t CTTN contributes to tumor cell invasion and metastasis.This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Two splice variants that encode different isoforms have been identified for this gene.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified

Accessory Products

  • LinkedIn