discontinued

NBP1-60056 Coxsackie Adenovirus Receptor antibody

See related secondary antibodies

Search for all "Coxsackie Adenovirus Receptor"

Quick Overview

Rabbit anti Human Coxsackie Adenovirus Receptor

Product Description for Coxsackie Adenovirus Receptor

Rabbit anti Human Coxsackie Adenovirus Receptor.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Coxsackie Adenovirus Receptor

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CAR, HCAR
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2R8V8
Immunogen:
Synthetic peptides corresponding to CXADR(coxsackie virus and adenovirus receptor) The peptide sequence was selected from the N terminal of CXADR. Peptide sequence ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK.
GeneID:
1525
Background CXADR is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 1525

Accessory Products

  • LinkedIn