discontinued

NBP1-60056 Coxsackie Adenovirus Receptor antibody

See related secondary antibodies

Search for all "Coxsackie Adenovirus Receptor"

50 µg / €390.00

Quick Overview

Rabbit anti Human Coxsackie Adenovirus Receptor

Product Description for Coxsackie Adenovirus Receptor

Rabbit anti Human Coxsackie Adenovirus Receptor.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Coxsackie Adenovirus Receptor

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CAR, HCAR
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2R8V8
Immunogen:
Synthetic peptides corresponding to CXADR(coxsackie virus and adenovirus receptor) The peptide sequence was selected from the N terminal of CXADR. Peptide sequence ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK.
GeneID:
1525
Background CXADR is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. The protein encoded by this gene is a type I membrane receptor for group B coxsackieviruses and subgroup C adenoviruses. Pseudogenes of this gene are found on chromosomes 15, 18, and 21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 1525

Accessory Products

  • LinkedIn