NBP1-56984 CRLF2 antibody

See related secondary antibodies

Search for all "CRLF2"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CRLF2

NBP1-56984

Product Description for CRLF2

Rabbit anti Human CRLF2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CRLF2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CRL2, CRLF2Y, TSLPR
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5G7M1
Immunogen:
Synthetic peptides corresponding to CRLF2 (cytokine receptor-like factor 2) The peptide sequence was selected from the middle region of CRLF2. Peptide sequence FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF.
GeneID:
64109
Background Cytokine signals are mediated through specific receptor complexes, the components of which are mostly members of the type I cytokine receptor family. Type I cytokine receptors share conserved structural features in their extracellular domain. Receptor complexes are typically heterodimeric, consisting of alpha chains, which provide ligand specificity, and beta (or gamma) chains, which are required for the formation of high-affinity binding sites and signal transduction.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 64109

Accessory Products

  • LinkedIn