
NBP1-56984 CRLF2 antibody

See related secondary antibodies

Search for all "CRLF2"

50 µg / €440.00

Quick Overview

Rabbit anti Human CRLF2


Product Description for CRLF2

Rabbit anti Human CRLF2.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for CRLF2

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CRL2, CRLF2Y, TSLPR
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CRLF2 (cytokine receptor-like factor 2) The peptide sequence was selected from the middle region of CRLF2. Peptide sequence FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF.
Background Cytokine signals are mediated through specific receptor complexes, the components of which are mostly members of the type I cytokine receptor family. Type I cytokine receptors share conserved structural features in their extracellular domain. Receptor complexes are typically heterodimeric, consisting of alpha chains, which provide ligand specificity, and beta (or gamma) chains, which are required for the formation of high-affinity binding sites and signal transduction.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 64109

Accessory Products

  • LinkedIn