H00441520-B01P CT45-4 antibody

See related secondary antibodies

Search for all "CT45-4"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CT45-4

H00441520-B01P

Product Description for CT45-4

Mouse anti Human CT45-4.
Product is tested for Western blot / Immunoblot.

Properties for CT45-4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N7B7
Immunogen:
CT45-4 (AAI53114.1, 1 a.a. ~ 189 a.a) full-length human protein.
AA Sequence:
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDF TGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQ GPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
GeneID:
101060211
Add. information Mouse polyclonal antibody raised against a full-length human CT45-4 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn