discontinued

H00001497-B01 CTNS MaxPab mouse antibody

See related secondary antibodies

Search for all "CTNS MaxPab mouse"

50 µl / €370.00

Quick Overview

Mouse anti Human CTNS MaxPab mouse

H00001497-B01

More Views

  • H00001497-B01

Product Description for CTNS MaxPab mouse

Mouse anti Human CTNS MaxPab mouse.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for CTNS MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µl
Synonyms CTNS-LSB, PQLC4, cystinosis, nephropathic
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZ01
Immunogen:
CTNS (AAH32850.1, 1 a.a. ~ 400 a.a) full-length human protein.
AA Sequence:
MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEV VVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSAISIINQVIGWIYFVAWSISFYPQVIMNWRR KSVIGLSFDFVALNLTGFVAYSVFNIGLLWVPYIKEQFLLKYPNGVNPVNSNDVFFSLHAVVLTLIIIVQCCLYER GGQRVSWPAIGFLVLAWLFAFVTMIVAAVGVITWLQFLFCFSYIKLAVTLVKYFPQAYMNFYYKSTEGWSIGNVLL DFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFSIVFDVVFFIQHFCLYRKRPGLQAARTGSGSRLRQDWAP SLQPKALPQTTSVSASSLKG
GeneID:
1497
Remarks:
Gene Accession: NM_001031681.1
Add. information Mouse polyclonal antibody raised against a full-length human CTNS protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human
Gene ID 1497

Accessory Products

  • LinkedIn