H00001504-M02 CTRB1 antibody

See related secondary antibodies

Search for all "CTRB1"

0.1 mg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CTRB1 3C8

H00001504-M02

Product Description for CTRB1

Mouse anti Human CTRB1 3C8.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for CTRB1

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms CTRB, FLJ42412, MGC88037, chymotrypsinogen B1
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 3C8
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
CTRB1 (NP_001897, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
LKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQA ALPLLSNAECKKSWGRRITDVMIC*
Remarks:
Gene Accession: NM_001906
Add. information Mouse monoclonal antibody raised against a partial recombinant CTRB1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Purity:
Antibody Reactive Against Recombinant Protein.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn