discontinued

H00008454-D01P Cullin 1 antibody

See related secondary antibodies

Search for all "Cullin 1"

Quick Overview

Rabbit anti Human Cullin 1

H00008454-D01P

More Views

  • H00008454-D01P

Product Description for Cullin 1

Rabbit anti Human Cullin 1.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for Cullin 1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CUL-1, CUL1, Cullin-1
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13616
Immunogen:
CUL1 (NP_003583.2, 1 a.a. ~ 776 a.a) full-length human protein.
AA Sequence:
MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQ TPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEG RKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVY KESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFH TEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNAL VMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYI EDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLD LDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQM AILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNI NVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKE YLERVDGEKDTYSYLA
GeneID:
8454
Remarks:
Gene Accession: NM_003592
Add. information Rabbit polyclonal antibody raised against a full-length human CUL1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,PLA-Ce,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 8454

Accessory Products

Proteins and/or Positive Controls

Proteins for Cullin 1 (7 products)

Catalog No. Species Pres. Purity   Source  

Cullin 1

Cullin 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Cullin 1 (1-410, His-tag)

Recombinant human CUL1, 1- 410 aa, His-tagged Human Purified > 95 % E. coli
0.25 mg / €750.00
  OriGene Technologies GmbH

Cullin 1 (1-410, His-tag)

Recombinant human CUL1, 1- 410 aa, His-tagged Human Purified > 95 % E. coli
50 µg / €300.00
  OriGene Technologies GmbH

Cullin 1

Cullin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cullin 1

Cullin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cullin 1

Cullin 1 Human Purified
  Novus Biologicals Inc.

Cullin 1

Cullin 1 Human Purified
  Novus Biologicals Inc.

Positive controls for Cullin 1 (1 products)

Catalog No. Species Pres. Purity   Source  

Cullin 1 Lysate

Western Blot: Cullin 1 Lysate [NBL1-09606] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CUL1
  Novus Biologicals Inc.
  • LinkedIn