TA330371 Cullin 1 antibody

Rabbit Polyclonal Anti-CUL1 Antibody

See related secondary antibodies

Search for all "Cullin 1"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Cullin 1

Product Description for Cullin 1

Rabbit anti Human Cullin 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cullin 1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CUL-1, CUL1, Cullin-1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q13616
Immunogen:
The immunogen for anti-CUL1 antibody: synthetic peptide directed towards the C terminal of human CUL1. Synthetic peptide located within the following region: HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA.
GeneID:
8454
Application WB
Background Cul1 may contribute to catalysis through the positioning of the substrate and the ubiquitin-conjugating enzyme
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cullin 1 (7 products)

Catalog No. Species Pres. Purity   Source  

Cullin 1

Cullin 1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Cullin 1 (1-410, His-tag)

Recombinant human CUL1, 1- 410 aa, His-tagged Human Purified > 95 % E. coli
0.25 mg / €750.00
  OriGene Technologies GmbH

Cullin 1 (1-410, His-tag)

Recombinant human CUL1, 1- 410 aa, His-tagged Human Purified > 95 % E. coli
50 µg / €300.00
  OriGene Technologies GmbH

Cullin 1

Cullin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cullin 1

Cullin 1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cullin 1

Cullin 1 Human Purified
  Novus Biologicals Inc.

Cullin 1

Cullin 1 Human Purified
  Novus Biologicals Inc.

Positive controls for Cullin 1 (1 products)

Catalog No. Species Pres. Purity   Source  

Cullin 1 Lysate

Western Blot: Cullin 1 Lysate [NBL1-09606] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CUL1
  Novus Biologicals Inc.
  • LinkedIn