NBP1-81747 CXorf27 antibody

See related secondary antibodies

Search for all "CXorf27"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CXorf27

Product Description for CXorf27

Rabbit anti Human CXorf27.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for CXorf27

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75409
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NPANIMSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPH
GeneID:
25763
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 25763

Accessory Products

Proteins and/or Positive Controls

Proteins for CXorf27 (2 products)

Catalog No. Species Pres. Purity   Source  

Chromosome X open reading frame 27 (CXorf27)

Chromosome X open reading frame 27 (CXorf27) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

CXorf27

CXorf27 Human
0.1 mg / €330.00
  Abnova Taiwan Corp.

Positive controls for CXorf27 (1 products)

Catalog No. Species Pres. Purity   Source  

HYPM overexpression lysate

HYPM overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn