H00159013-B01P CXorf38 antibody

See related secondary antibodies

Search for all "CXorf38"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CXorf38

H00159013-B01P

Product Description for CXorf38

Mouse anti Human CXorf38.
Product is tested for Western blot / Immunoblot.

Properties for CXorf38

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms MGC39350
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TB03
Immunogen:
CXorf38 (NP_659407.1, 1 a.a. ~ 319 a.a) full-length human protein.
AA Sequence:
MVLSELAARLNCAEYKNWVKAGHCLLLLRSCLQGFVGREVLSFHRGLLAAAPGLGPRAVCRGGSRCSPRARQFQPQ CQVCAEWKREILRHHVNRNGDVHWGNCRPGRWPVDAWEVAKAFMPRGLADKQGPEECDAVALLSLINSCDHFVVDR KKVTEVIKCRNEIMHSSEMKVSSTWLRDFQMKIQNFLNEFKNIPEIVAVYSRIEQLLTSDWAVHIPEEDQRDGCEC EMGTYLSESQVNEIEMQLLKEKLQEIYLQAEEQEVLPEELSNRLEVVKEFLRNNEDLRNGLTEDMQKLDSLCLHQK LDSQEPGRQTPDRKA
GeneID:
159013
Add. information Mouse polyclonal antibody raised against a full-length human CXorf38 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for CXorf38 (1 products)

Catalog No. Species Pres. Purity   Source  

Chromosome X open reading frame 38 (CXorf38)

Chromosome X open reading frame 38 (CXorf38) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for CXorf38 (1 products)

Catalog No. Species Pres. Purity   Source  

CXorf38 overexpression lysate

CXorf38 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn