TA345051 CYB5R4 antibody

Rabbit Polyclonal Anti-CYB5R4 Antibody - N-terminal region

See related secondary antibodies

Search for all "CYB5R4"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Rabbit, Rat, Zebrafish CYB5R4

Product Description for CYB5R4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Mouse, Rabbit, Rat, Zebrafish CYB5R4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYB5R4

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Cytochrome b5 reductase 4, Flavohemoprotein b5/b5R, N-terminal cytochrome b5 and cytochrome b5 oxidoreductase domain-containing protein, NCB5OR, cb5/cb5R
Presentation Purified
Reactivity Bov, Can, Eq, GP, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-Cyb5r4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSQAFPAPGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGL.
Application WB
Background The function of this protein remains unknown.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for CYB5R4 (5 products)

Catalog No. Species Pres. Purity   Source  


CYB5R4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.


CYB5R4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


CYB5R4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


CYB5R4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


CYB5R4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CYB5R4 (2 products)

Catalog No. Species Pres. Purity   Source  

CYB5R4 Lysate

Western Blot: CYB5R4 Lysate [NBL1-09656] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CYB5R4
  Novus Biologicals Inc.

CYB5R4 overexpression lysate

CYB5R4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn