discontinued

H00000900-B01P Cyclin G1 antibody

See related secondary antibodies

Search for all "Cyclin G1"

Quick Overview

Mouse anti Human Cyclin G1

H00000900-B01P

More Views

  • H00000900-B01P

Product Description for Cyclin G1

Mouse anti Human Cyclin G1.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for Cyclin G1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CCNG, CCNG1, CYCG1, Cyclin-G, Cyclin-G1
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P51959
Immunogen:
CCNG1 (NP_004051.1, 1 a.a. ~ 295 a.a) full-length human protein.
AA Sequence:
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLA VNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVKAT TAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQ KHSKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
GeneID:
900
Remarks:
Gene Accession: NM_004060
Add. information Mouse polyclonal antibody raised against a full-length human CCNG1 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 900

Accessory Products

Proteins and/or Positive Controls

Proteins for Cyclin G1 (7 products)

Catalog No. Species Pres. Purity   Source  

Cyclin G1 (full length, C-term DDK tag, transcript variant 2)

Cyclin G1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

Cyclin G1 (1-295, His-tag)

Cyclin G1 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €730.00
  OriGene Technologies GmbH

Cyclin G1 (1-295, His-tag)

Cyclin G1 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €300.00
  OriGene Technologies GmbH

Cyclin G1

Cyclin G1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Cyclin G1 (3 products)

Catalog No. Species Pres. Purity   Source  

CCNG1 293T Cell Transient Overexpression Lysate(Denatured)

CCNG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCNG1 overexpression lysate

CCNG1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Cyclin G Lysate

Western Blot: Cyclin G Lysate [NBL1-08880] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CCNG1.
  Novus Biologicals Inc.
  • LinkedIn