discontinued

H00000900-M01 Cyclin G1 antibody

See related secondary antibodies

Search for all "Cyclin G1"

Quick Overview

Mouse anti Human Cyclin G1 1E3

Product Description for Cyclin G1

Mouse anti Human Cyclin G1 1E3.
Presentation: Purified
Product is tested for Enzyme Immunoassay.

Properties for Cyclin G1

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms CCNG, CCNG1, CYCG1, Cyclin-G, Cyclin-G1
Presentation Purified
Reactivity Hu
Applications E
Clonality Monoclonal
Clone 1E3
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P51959
Immunogen:
CCNG1 (AAH00196, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLA VNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIE
GeneID:
900
Remarks:
Gene Accession: BC000196
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant CCNG1.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 900

Accessory Products

Proteins and/or Positive Controls

Proteins for Cyclin G1 (7 products)

Catalog No. Species Pres. Purity   Source  

Cyclin G1 (full length, C-term DDK tag, transcript variant 2)

Cyclin G1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

Cyclin G1 (1-295, His-tag)

Cyclin G1 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

Cyclin G1 (1-295, His-tag)

Cyclin G1 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH

Cyclin G1

Cyclin G1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Cyclin G1 (3 products)

Catalog No. Species Pres. Purity   Source  

CCNG1 293T Cell Transient Overexpression Lysate(Denatured)

CCNG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCNG1 overexpression lysate

CCNG1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

Cyclin G Lysate

Western Blot: Cyclin G Lysate [NBL1-08880] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CCNG1.
  Novus Biologicals Inc.
  • LinkedIn