TA330352 Cyclin G1 antibody

Rabbit Polyclonal Anti-CCNG1 Antibody

See related secondary antibodies

Search for all "Cyclin G1"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Cyclin G1

Product Description for Cyclin G1

Rabbit anti Human Cyclin G1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cyclin G1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CCNG, CCNG1, CYCG1, Cyclin-G, Cyclin-G1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51959
Immunogen:
The immunogen for anti-CCNG1 antibody: synthetic peptide directed towards the N terminal of human CCNG1. Synthetic peptide located within the following region: IEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARL.
GeneID:
900
Application WB
Background The eukaryotic cell cycle is governed by cyclin-dependent protein kises (CDKs) whose activities are regulated by cyclins and CDK inhibitors. CCNG1 is a member of the cyclin family and contains the cyclin box. It lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptiol activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene.The eukaryotic cell cycle is governed by cyclin-dependent protein kises (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptiol activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cyclin G1 (7 products)

Catalog No. Species Pres. Purity   Source  

Cyclin G1 (full length, C-term DDK tag, transcript variant 2)

Cyclin G1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
SF9 cells
20 µg / €399.00
  OriGene Technologies, Inc.

Cyclin G1 (1-295, His-tag)

Cyclin G1 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €730.00
  Acris Antibodies GmbH

Cyclin G1 (1-295, His-tag)

Cyclin G1 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €300.00
  Acris Antibodies GmbH

Cyclin G1

Cyclin G1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cyclin G1

Cyclin G1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Cyclin G1 (3 products)

Catalog No. Species Pres. Purity   Source  

CCNG1 293T Cell Transient Overexpression Lysate(Denatured)

CCNG1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCNG1 overexpression lysate

CCNG1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

Cyclin G Lysate

Western Blot: Cyclin G Lysate [NBL1-08880] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CCNG1.
  Novus Biologicals Inc.
  • LinkedIn