TA340101 Cyclophilin H / PPIH antibody

Rabbit Polyclonal Anti-PPIH Antibody

See related secondary antibodies

Search for all "Cyclophilin H / PPIH"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish Cyclophilin H / PPIH

Product Description for Cyclophilin H / PPIH

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish Cyclophilin H / PPIH.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cyclophilin H / PPIH

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CYP20, CYPH, PPIase H, Peptidyl-prolyl cis-trans isomerase H, Rotamase H, Small nuclear ribonucleoprotein particle-specific cyclophilin H, SnuCyp-20, U-snRNP-associated cyclophilin SnuCyp-20, USA-CYP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-PPIH antibody: synthetic peptide directed towards the middle region of human PPIH. Synthetic peptide located within the following region: DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN.
Application WB
Background The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mR processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Cyclophilin H / PPIH (10 products)

Catalog No. Species Pres. Purity   Source  

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

Cyclophilin H / PPIH (1-177)

Cyclophilin H / PPIH Human Purified > 95 % by SDS PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

Cyclophilin H / PPIH (1-177)

Cyclophilin H / PPIH Human Purified > 95 % by SDS PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human
  Abnova Taiwan Corp.

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human Purified 95 % E. coli
  GenWay Biotech Inc.

Cyclophilin H / PPIH

Cyclophilin H / PPIH Human Purified 95 % E. coli
  GenWay Biotech Inc.

Cyclophilin H / PPIH

SDS-Page: PPIH Protein [NBC1-18434] - Cyclophilin H(PPIH), 19.2 kDa (177 aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for Cyclophilin H / PPIH (1 products)

Catalog No. Species Pres. Purity   Source  

PPIH Lysate

Western Blot: PPIH Lysate [NBL1-14650] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPIH
  Novus Biologicals Inc.
  • LinkedIn