H00192668-B01P CYS1 antibody

See related secondary antibodies

Search for all "CYS1"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human CYS1

H00192668-B01P

Product Description for CYS1

Mouse anti Human CYS1.
Product is tested for Western blot / Immunoblot.

Properties for CYS1

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ33980
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q717R9
Immunogen:
CYS1 (AAI48589.1, 1 a.a. ~ 158 a.a) full-length human protein.
AA Sequence:
MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSPVAPPDGRDETLRLLDE LLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSGNVSEAPGSGRKKPERPAAISYDHSEEGLMASI EREYCR
GeneID:
192668
Add. information Mouse polyclonal antibody raised against a full-length human CYS1 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for CYS1 (1 products)

Catalog No. Species Pres. Purity   Source  

CYS1 overexpression lysate

CYS1 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn