
NBP1-69671 Cytochrome P450 2D6 antibody

See related secondary antibodies

Search for all "Cytochrome P450 2D6"

50 µg / €440.00

Quick Overview

Rabbit anti Human, Rat Cytochrome P450 2D6

Product Description for Cytochrome P450 2D6

Rabbit anti Human, Rat Cytochrome P450 2D6.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Cytochrome P450 2D6

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to CYP2D6(cytochrome P450, family 2, subfamily D, polypeptide 6) The peptide sequence was selected from the middle region of CYP2D6. Peptide sequence EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV.
Background CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 1565

Accessory Products

  • LinkedIn