
NBP1-59779 Cytochrome P450 Reductase antibody

See related secondary antibodies

Search for all "Cytochrome P450 Reductase"

0.1 mg / €360.00

Quick Overview

Rabbit anti Human, Mouse, Rat Cytochrome P450 Reductase

Product Description for Cytochrome P450 Reductase

Rabbit anti Human, Mouse, Rat Cytochrome P450 Reductase.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Cytochrome P450 Reductase

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms anti-CPR antibody, anti-CYPOR antibody, anti-DKFZp686G04235 antibody, anti-FLJ26468 antibody, anti-P450R antibody
Presentation Purified
Reactivity Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to POR(P450 (cytochrome) oxidoreductase) The peptide sequence was selected from the N terminal of POR. Peptide sequence IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT.
Background POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Storage Store at -20C. Avoid freeze-thaw cycles.
IgG purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 100 ul of distilled water. Final antibody concentration is 1 mg/ml.

Accessory Products

  • LinkedIn