TA337398 Cytokeratin 26 antibody

Rabbit Polyclonal Anti-KRT26 Antibody

See related secondary antibodies

Search for all "Cytokeratin 26"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rabbit Cytokeratin 26

Product Description for Cytokeratin 26

Rabbit anti Human, Rabbit Cytokeratin 26.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cytokeratin 26

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KRT25B, KRT26, Keratin, Keratin-26, Type I inner root sheath-specific keratin-K25irs2, type I cytoskeletal 26
Presentation Purified
Reactivity Hu, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-KRT26 antibody is: synthetic peptide directed towards the C-terminal region of Human KRT26. Synthetic peptide located within the following region: IDIYCNLLDGEERKSKSTCYKSKGYRPVNSGNQAKDSTEETIVKTVVEEL.
Application WB
Background The protein encoded by this gene is a member of the keratin superfamily. This keratin protein is a type I keratin that is specific for the inner root sheath of the hair follicle. This gene exists in a cluster with other keratin genes on chromosome 17q21.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for Cytokeratin 26 (1 products)

Catalog No. Species Pres. Purity   Source  

Cytokeratin 26 (full length, N-term HIS tag)

Cytokeratin 26 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

Positive controls for Cytokeratin 26 (1 products)

Catalog No. Species Pres. Purity   Source  

KRT26 overexpression lysate

KRT26 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn