discontinued

NBP1-53187 Cytokeratin 7 antibody

See related secondary antibodies

Search for all "Cytokeratin 7"

50 µg / €390.00

Quick Overview

Rabbit anti Human Cytokeratin 7

Product Description for Cytokeratin 7

Rabbit anti Human Cytokeratin 7.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Cytokeratin 7

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CK7, K2C7, K7, MGC129731, MGC3625, SCL
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A5A6N0
Immunogen:
Synthetic peptides corresponding to KRT7(keratin 7) The peptide sequence was selected from the N terminal of KRT7. Peptide sequence SIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAV.
GeneID:
466983
Background KRT7 is a member of the keratin protein family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 466983

Accessory Products

  • LinkedIn