TA338223 DAG kinase delta antibody

Rabbit Polyclonal Anti-DGKD Antibody

See related secondary antibodies

Search for all "DAG kinase delta"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rabbit, Rat DAG kinase delta

Product Description for DAG kinase delta

Rabbit anti Canine, Guinea Pig, Human, Mouse, Rabbit, Rat DAG kinase delta.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DAG kinase delta

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DGK-delta, DGKD, Diacylglycerol kinase delta, Diglyceride kinase delta, KIAA0145
Presentation Purified
Reactivity Can, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DGKD antibody is: synthetic peptide directed towards the C-terminal region of Human DGKD. Synthetic peptide located within the following region: KRSRSGKFRLVTKFKKEKNNKNKEAHSSLGAPVHLWGTEEVAAWLEHLSL.
Application WB
Background This gene encodes a cytoplasmic enzyme that phosphorylates diacylglycerol to produce phosphatidic acid. Diacylglycerol and phosphatidic acid are two lipids that act as second messengers in sigling cascades. Their cellular concentrations are regulated by the encoded protein, and so it is thought to play an important role in cellular sigl transduction. Altertive splicing results in two transcript variants encoding different isoforms.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DAG kinase delta (2 products)

Catalog No. Species Pres. Purity   Source  

DAG kinase delta (transcript variant 2)

DAG kinase delta Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

DAG kinase delta

DAG kinase delta Human
  Abnova Taiwan Corp.

Positive controls for DAG kinase delta (1 products)

Catalog No. Species Pres. Purity   Source  

DGKD overexpression lysate

DGKD overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn