discontinued

H00026007-B01P DAK antibody

See related secondary antibodies

Search for all "DAK"

Quick Overview

Mouse anti Human DAK

H00026007-B01P

More Views

  • H00026007-B01P

Product Description for DAK

Mouse anti Human DAK.
Presentation: Purified
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for DAK

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DKFZp586B1621, Dihydroxyacetone kinase 2 homolog, MGC5621, NET45
Presentation Purified
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3LXA3
Immunogen:
DAK (NP_056348.2, 1 a.a. ~ 575 a.a) full-length human protein.
AA Sequence:
MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHEPAHAGFIGKGMLTGVI AGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDDSAFTVLKKAGRR GLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAKAMGTLGVSLSSCSVPGSKPTFELSADEVELGLGIHGEAGVRR IKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGIIADATVRSLEGRGVKIARALVGTFM SALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRSRVAPAEPQEAPDSTAAGGSASKRMALVLER VCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLKEGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLT AAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAPGDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAE ATKNMEAGAGRASYISSARLEQPDPGAVAAAAILRAILEVLQS
GeneID:
26007
Remarks:
Gene Accession: NM_015533.3
Add. information Mouse polyclonal antibody raised against a full-length human DAK protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 26007

Accessory Products

Proteins and/or Positive Controls

Proteins for DAK (6 products)

Catalog No. Species Pres. Purity   Source  

DAK

DAK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

DAK

DAK Human in vitro transl.
  Abnova Taiwan Corp.

DAK

DAK Human in vitro transl.
  Abnova Taiwan Corp.

DAK

DAK Human in vitro transl.
  Abnova Taiwan Corp.

DAK

DAK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DAK

DAK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DAK (2 products)

Catalog No. Species Pres. Purity   Source  

DAK 293T Cell Transient Overexpression Lysate(Denatured)

DAK 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TKFC overexpression lysate

TKFC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn