TA333812 DAK antibody

Rabbit Polyclonal Anti-DAK Antibody

See related secondary antibodies

Search for all "DAK"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DAK

TA333812

More Views

  • TA333812

Product Description for DAK

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DAK.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for DAK

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms DKFZp586B1621, Dihydroxyacetone kinase 2 homolog, MGC5621, NET45
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3LXA3
Immunogen:
The immunogen for Anti-DAK Antibody: synthetic peptide directed towards the N terminal of human DAK. Synthetic peptide located within the following region: MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA.
GeneID:
26007
Application IHC
WB
Background This gene is a member of the family of dihydroxyacetone kises, which have a protein structure distinct from other kises. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several altertively spliced transcript variants have been identified, but the full-length ture of only one has been determined. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DAK (6 products)

Catalog No. Species Pres. Purity   Source  

DAK

DAK Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

DAK

DAK Human in vitro transl.
  Abnova Taiwan Corp.

DAK

DAK Human in vitro transl.
  Abnova Taiwan Corp.

DAK

DAK Human in vitro transl.
  Abnova Taiwan Corp.

DAK

DAK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DAK

DAK Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DAK (2 products)

Catalog No. Species Pres. Purity   Source  

DAK 293T Cell Transient Overexpression Lysate(Denatured)

DAK 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TKFC overexpression lysate

TKFC overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn