TA344519 DBP antibody

Rabbit Polyclonal Anti-DBP Antibody - C-terminal region

See related secondary antibodies

Search for all "DBP"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Sheep DBP

Product Description for DBP

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat, Sheep DBP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DBP

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Albumin D box-binding protein, Albumin D-element-binding protein, D site of albumin promoter (albumin D-box) binding protein, D site-binding protein, DABP, TaxREB302
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-DBP antibody: synthetic peptide directed towards the C terminal of human DBP. Synthetic peptide located within the following region: FSEEELKPQPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLK.
Application WB
Background DBP is a member of the PAR bZIP (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It is transcriptiol activator that recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin, CYP2A4 and CYP2A5. The protein is not essential for circadian rhythm generation, but modulates important clock output genes.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for DBP (2 products)

Catalog No. Species Pres. Purity   Source  


DBP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.


DBP Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DBP (1 products)

Catalog No. Species Pres. Purity   Source  

D Box Binding Protein Lysate

Western Blot: D Box Binding Protein Lysate [NBL1-09733] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for DBP.
  Novus Biologicals Inc.
  • LinkedIn